HPA011380

PDE9A antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011380
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011380, RRID:AB_1855132
Product name
Anti-PDE9A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011380
Antibody type
Polyclonal
Antigen
High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ECNIFSNIPPDGFKQIRQGMITLILATDMARHAEI
MDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNE
VRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPF
MDRDKVTKATAQIGFIKFVLIPMF
Storage
-20C
Provider Type Product Number
- No reagents -