R32186

HHEX antibody from NSJ Bioreagents
HEX, HOX11L-PEN, PRHX

Antibody data

Product number
R32186
Provider
NSJ Bioreagents
Product name
HHEX Antibody / HEX
Provider product page
NSJ Bioreagents - R32186
Antibody type
Polyclonal
Antigen
Amino acids NDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ of human HHEX were used as the immunogen for the HHEX antibody.
Description
Antigen affinity
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Vial size
100 µg
Concentration
Lyophilized; resuspend with 200 ul for 0.5 mg/ml
Storage
After reconstitution, the HHEX antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -