HPA022251

NYAP1 antibody from Sigma-Aldrich
C7orf51, FLJ37538, KIAA1486L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022251
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022251, RRID:AB_1848915
Product name
Anti-C7orf51 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022251
Antibody type
Polyclonal
Antigen
Uncharacterized protein C7orf51 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WTYPATAAGLKRPPAYESLKAGGVLNKGCGVGAPS
PMVKIQLQEQGTDGGAFASISCAHVIASAGTPEEE
EEEVGAATFGAGWALQRKVLYGGRKAKELD
Storage
-20C
Provider Type Product Number
- No reagents -