HPA007879

ANGPTL4 antibody from Sigma-Aldrich
ARP4, FIAF, HFARP, NL2, PGAR, pp1158
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007879
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007879, RRID:AB_1078158
Product name
Anti-ANGPTL4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007879
Antibody type
Polyclonal
Antigen
Angiopoietin-related protein 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFW
LGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSV
HLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPF
STWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNG
QYFRSI
Storage
-20C
Provider Type Product Number
- No reagents -