H00003487-B01

IGFBP4 antibody from Abnova Corporation
BP-4, HT29-IGFBP, IBP4, IGFBP-4

Antibody data

Product number
H00003487-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003487-B01, RRID:AB_1204529
Product name
IGFBP4 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00003487-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human IGFBP4 protein.
Antigen sequence
MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKL
ARCRPPVGCEELVREPGCGCCATCALGLGMPCGVY
TPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAE
IEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQ
KHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQ
SELHRALERLAASQSRTHEDLYIIPIPNCDRNGNF
HPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKG
ELDCHQLADSFRE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -