Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405754 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Insulin-Like Growth Factor Binding Protein 4 (IGFBP4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IGFBP4 antibody: synthetic peptide directed towards the middle region of human IGFBP4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQ
CHPAL DGQRGKCWCV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references SOX9 directly regulates IGFBP-4 in the intestinal epithelium.
Increased apoptosis and decreased proliferation of colorectal cancer cells using insulin-like growth factor binding protein-4 gene delivered locally by gene transfer.
Shi Z, Chiang CI, Mistretta TA, Major A, Mori-Akiyama Y
American journal of physiology. Gastrointestinal and liver physiology 2013 Jul 1;305(1):G74-83
American journal of physiology. Gastrointestinal and liver physiology 2013 Jul 1;305(1):G74-83
Increased apoptosis and decreased proliferation of colorectal cancer cells using insulin-like growth factor binding protein-4 gene delivered locally by gene transfer.
Durai R, Yang SY, Sales KM, Seifalian AM, Goldspink G, Winslet MC
Colorectal disease : the official journal of the Association of Coloproctology of Great Britain and Ireland 2007 Sep;9(7):625-31
Colorectal disease : the official journal of the Association of Coloproctology of Great Britain and Ireland 2007 Sep;9(7):625-31
No comments: Submit comment
No validations: Submit validation data