ABIN405754

IGFBP4 antibody from antibodies-online
BP-4, HT29-IGFBP, IBP4, IGFBP-4
Western blot
Recommended by provider
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
ABIN405754
Provider
antibodies-online
Product name
anti-Insulin-Like Growth Factor Binding Protein 4 (IGFBP4) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405754
Antibody type
Polyclonal
Antigen
The immunogen for anti-IGFBP4 antibody: synthetic peptide directed towards the middle region of human IGFBP4
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
Host
Rabbit
Antigen sequence
RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQ
CHPAL DGQRGKCWCV
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -