HPA016815

ZBTB20 antibody from Sigma-Aldrich
DKFZp566F123, DPZF, ODA-8S, ZNF288
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016815
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016815, RRID:AB_1858947
Product name
Anti-ZBTB20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016815
Antibody type
Polyclonal
Antigen
Zinc finger and BTB domain-containing protein 20 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVEQQFGPGAARDSQAEPTQPEQAAEAPAEGGPQT
NQLETGASSPERSNEVEMDSTVITVSNSSDKSVLQ
QPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTL
TSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSL
PQPLAGQQTQ
Storage
-20C
Provider Type Product Number
- No reagents -