HPA016815

ZBTB20 antibody from Atlas Antibodies
DKFZp566F123, DPZF, ODA-8S, ZNF288
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016815
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016815, RRID:AB_1858947
Product name
Anti-ZBTB20
Provider product page
Atlas Antibodies - HPA016815
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SVEQQFGPGAARDSQAEPTQPEQAAEAPAEGGPQT
NQLETGASSPERSNEVEMDSTVITVSNSSDKSVLQ
QPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTL
TSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSL
PQPLAGQQTQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -