HPA015770

DCLK2 antibody from Sigma-Aldrich
DCAMKL2, DCDC3, DCDC3B, DCK2, MGC45428
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015770
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015770, RRID:AB_1847509
Product name
Anti-DCLK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015770
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase DCLK2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMN
TALDKEGQIFCSKHCQDSGRPGMEPISPVPPSVEE
IPVPGEAVPAPTPPESPTPHCPPAAPGGERAG
Storage
-20C
Provider Type Product Number
- No reagents -