HPA015770

DCLK2 antibody from Atlas Antibodies
DCAMKL2, DCDC3, DCDC3B, DCK2, MGC45428
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015770
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015770, RRID:AB_1847509
Product name
Anti-DCLK2
Provider product page
Atlas Antibodies - HPA015770
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMN
TALDKEGQIFCSKHCQDSGRPGMEPISPVPPSVEE
IPVPGEAVPAPTPPESPTPHCPPAAPGGERAG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -