HPA003543

AK7 antibody from Sigma-Aldrich
FLJ32864
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003543
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003543, RRID:AB_1078117
Product name
Anti-AK7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003543
Antibody type
Polyclonal
Antigen
Putative adenylate kinase 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QAKDLFNQEDEEEEDDVRGRMFPFDKLIIPEFVCA
LDASDEFLKERVINLPESIVAGTHYSQDRFLRALS
NYRDINIDDETVFNYFDELEIHPIHIDVGKLEDAQ
NRLAIKQLIKEIGEPRNYGLTDEEKAEEE
Storage
-20C
Provider Type Product Number
- No reagents -