Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002194-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002194-M01, RRID:AB_425426
- Product name
- FASN monoclonal antibody (M01), clone 3F2-1F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant FASN.
- Antigen sequence
MSTNDTIVSGTLPQRMASCLEVLDLFLNQPHMVLS
SFVLAEKAAAYRDRDSQRDLVEAVAHILGIRDLAA
VNLDSSLADLGLDSLMSVEVRQTLERELNLVLSVR
EVRQLTLRKLQELSSKADEASELACPTPKEDGLAQ
QQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLV
HPIEGSTTVFHSLASGLSIPTYGLQCTRAAPLDSI
HSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEM
CSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYR
AKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEAL
LPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARS
FYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGED
LGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLES
IISIIHSSLAEPRVSVREG- Isotype
- IgG
- Antibody clone number
- 3F2-1F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Myoglobin expression in prostate cancer is correlated to androgen receptor expression and markers of tumor hypoxia.
Old proteins - new locations: myoglobin, haemoglobin, neuroglobin and cytoglobin in solid tumours and cancer cells.
Endogenous myoglobin in human breast cancer is a hallmark of luminal cancer phenotype.
Meller S, Bicker A, Montani M, Ikenberg K, Rostamzadeh B, Sailer V, Wild P, Dietrich D, Uhl B, Sulser T, Moch H, Gorr TA, Stephan C, Jung K, Hankeln T, Kristiansen G
Virchows Archiv : an international journal of pathology 2014 Oct;465(4):419-27
Virchows Archiv : an international journal of pathology 2014 Oct;465(4):419-27
Old proteins - new locations: myoglobin, haemoglobin, neuroglobin and cytoglobin in solid tumours and cancer cells.
Gorr TA, Wichmann D, Pilarsky C, Theurillat JP, Fabrizius A, Laufs T, Bauer T, Koslowski M, Horn S, Burmester T, Hankeln T, Kristiansen G
Acta physiologica (Oxford, England) 2011 Jul;202(3):563-81
Acta physiologica (Oxford, England) 2011 Jul;202(3):563-81
Endogenous myoglobin in human breast cancer is a hallmark of luminal cancer phenotype.
Kristiansen G, Rose M, Geisler C, Fritzsche FR, Gerhardt J, Lüke C, Ladhoff AM, Knüchel R, Dietel M, Moch H, Varga Z, Theurillat JP, Gorr TA, Dahl E
British journal of cancer 2010 Jun 8;102(12):1736-45
British journal of cancer 2010 Jun 8;102(12):1736-45
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FASN monoclonal antibody (M01), clone 3F2-1F3 Western Blot analysis of FASN expression in 293 ( Cat # L026V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FASN expression in transfected 293T cell line by FASN monoclonal antibody (M01), clone 3F2-1F3.Lane 1: FASN transfected lysate(48.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FASN is 0.1 ng/ml as a capture antibody.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to FASN on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of FASN transfected lysate using anti-FASN monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FASN MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to FASN on formalin-fixed paraffin-embedded human breast cancer tissue. [antibody concentration 10 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol