HPA006461

FASN antibody from Atlas Antibodies
FAS, SDR27X1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006461
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006461, RRID:AB_1848437
Product name
Anti-FASN
Provider product page
Atlas Antibodies - HPA006461
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEK
FCFTPHTEEGCLSERAALQEELQLCKGLVQALQTK
VTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAAC
RLQLNGN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -