HPA006461

FASN antibody from Sigma-Aldrich
FAS, SDR27X1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006461
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006461, RRID:AB_1848437
Product name
Anti-FASN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006461
Antibody type
Polyclonal
Antigen
Fatty acid synthase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEK
FCFTPHTEEGCLSERAALQEELQLCKGLVQALQTK
VTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAAC
RLQLNGN
Storage
-20C
Provider Type Product Number
- No reagents -