HPA030166

TJAP1 antibody from MilliporeSigma / Merck KGaA
PILT, TJP4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030166
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030166, RRID:AB_10601858
Product name
Anti-TJAP1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030166
Antibody type
Polyclonal
Antigen
tight junction associated protein 1 (peripheral) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLDCNLAVQLLKCNKSHFRNHKFADLPCELQDMVR
KHLHSGQEAASPGPAPSLAPGAVVPTSVIARVLEK
PESLLLNSAQS
Storage
-20C
Provider Type Product Number
- No reagents -