HPA023597

LRBA antibody from Sigma-Aldrich
BGL, CDC4L, LAB300, LBA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023597
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023597, RRID:AB_1853256
Product name
Anti-LRBA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023597
Antibody type
Polyclonal
Antigen
Lipopolysaccharide-responsive and beige-like anchor protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGWRVWVDTLSITHSKVTFEIHKENLANIFREQQG
KVDEEIGLCSSTSVQAASGIRRDINVSVGSQQPDT
KDSPVCPHFTTNGNENSSIEKTSSLESASNIELQT
TNTSYEEMKAEQENQELPDEGTLEETL
Storage
-20C
Provider Type Product Number
- No reagents -