Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109591 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 449 (ZNF449) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF449 antibody: synthetic peptide directed towards the middle region of human ZNF449.
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
LENREEPWVKELQDSKEMKQLLDSKIGFEIGIENE
EDTSKQKKMETMYPF- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Identification and characterization of the human SCAN domain zinc-finger gene ZNF449.
Luo K, Li J, Cui Y, Xu M, Yuan J, Tang W, Wan B, Yu L
Molecular biology reports 2006 Mar;33(1):51-7
Molecular biology reports 2006 Mar;33(1):51-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Transfected 293T; WB Suggested Anti-ZNF449 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Transfected 293T; ZNF449 antibody - middle region (AP42048PU-N) in Transfected 293T cells using Western Blot