HPA018079

ZNF449 antibody from MilliporeSigma / Merck KGaA
FLJ23614, ZSCAN19
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018079
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018079, RRID:AB_1859277
Product name
Anti-ZNF449 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018079
Antibody type
Polyclonal
Antigen
Zinc finger protein 449 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LELLVLEQFLTILPTEIETWVREHCPENRERVVSL
IEDLQRELEIPEQQVDMHDMLLEELAPVGTAHIPP
TMHLESPALQVMGPAQEAPVAEAWIPQAGPPELNY
GATGECQN
Storage
-20C
Provider Type Product Number
- No reagents -