HPA008840

DUSP12 antibody from Atlas Antibodies
DUSP1, YVH1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008840
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008840, RRID:AB_1847884
Product name
Anti-DUSP12
Provider product page
Atlas Antibodies - HPA008840
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQ
ELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSI
LDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYF
IEPVQWMESALLGVMDGQLLCPKCSAKLGSFNWYG
EQCSCGRWI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -