HPA014659

UAP1 antibody from Sigma-Aldrich
AgX, AGX1, SPAG2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014659
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014659, RRID:AB_1857409
Product name
Anti-UAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014659
Antibody type
Polyclonal
Antigen
UDP-N-acetylhexosamine pyrophosphorylase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQ
AMNFEELNFFFQKAIEGFNQSSHQKNVDARMEPVP
REVLGSATRDQDQLQAWESEGLFQISQNKVAVLLL
AGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQAERI
LKLQQ
Storage
-20C
Provider Type Product Number
- No reagents -