Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014659 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA014659, RRID:AB_1857409
- Product name
- Anti-UAP1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQ
AMNFEELNFFFQKAIEGFNQSSHQKNVDARMEPVP
REVLGSATRDQDQLQAWESEGLFQISQNKVAVLLL
AGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQAERI
LKLQQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references N-linked glycosylation supports cross-talk between receptor tyrosine kinases and androgen receptor.
Itkonen HM, Mills IG
PloS one 2013;8(5):e65016
PloS one 2013;8(5):e65016
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-UAP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN