HPA016599

SLC19A2 antibody from Sigma-Aldrich
THTR1, TRMA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016599
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016599, RRID:AB_1857005
Product name
Anti-SLC19A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016599
Antibody type
Polyclonal
Antigen
Thiamine transporter 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RECWFLPTALLCAYGFFASLRPSEPFLTPYLLGPD
KNLTEREEPKPDRLLVLKVLWNDFLMCYSSR
Storage
-20C
Provider Type Product Number
- No reagents -