HPA016825

ZBTB43 antibody from Sigma-Aldrich
FLJ22470, KIAA0414, ZBTB22B, ZNF-X, ZNF297B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016825
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016825, RRID:AB_1858959
Product name
Anti-ZBTB43 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016825
Antibody type
Polyclonal
Antigen
Zinc finger and BTB domain-containing protein 43 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGS
SMEEFSGERSDGNLIGHRQEAALAAGYSENIEMVT
GIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRH
MSMHLGL
Storage
-20C
Provider Type Product Number
- No reagents -