HPA016825

ZBTB43 antibody from Atlas Antibodies
FLJ22470, KIAA0414, ZBTB22B, ZNF-X, ZNF297B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016825
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016825, RRID:AB_1858959
Product name
Anti-ZBTB43
Provider product page
Atlas Antibodies - HPA016825
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGS
SMEEFSGERSDGNLIGHRQEAALAAGYSENIEMVT
GIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRH
MSMHLGL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -