HPA023687

DAP3 antibody from Atlas Antibodies
bMRP-10, DAP-3, DKFZp686G12159, MGC126058, MGC126059, MRP-S29, MRPS29
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023687
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023687, RRID:AB_1847472
Product name
Anti-DAP3
Provider product page
Atlas Antibodies - HPA023687
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSL
GMFHLLVAVDGINALWGRTTLKREDKSPIAPEELA
LVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAY
LPQELLGKEGFDALDPFIPILVSNYNPKEF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -