HPA006076

DAP3 antibody from Sigma-Aldrich
bMRP-10, DAP-3, DKFZp686G12159, MGC126058, MGC126059, MRP-S29, MRPS29
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006076
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006076, RRID:AB_1078621
Product name
Anti-DAP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006076
Antibody type
Polyclonal
Antigen
28S ribosomal protein S29, mitochondrial (S29mt)(MRP-S29) (Death-associated protein 3) (DAP-3) (Ionizing radiation resistance conferring protein)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HEGQHYNISPQDLETVFPHGLPPRFVMQVKTFSEA
CLMVRKPALELLHYLKNTSFAYPAIRYLLYGEKGT
GKTLSLCHVIHFCAKQDWLILHIPDAHLWVKNCRD
LLQSSYNKQRFDQPLEASTWLKNF
Storage
-20C
Provider Type Product Number
- No reagents -