HPA023687

DAP3 antibody from Sigma-Aldrich
bMRP-10, DAP-3, DKFZp686G12159, MGC126058, MGC126059, MRP-S29, MRPS29
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023687
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023687, RRID:AB_1847472
Product name
Anti-DAP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023687
Antibody type
Polyclonal
Antigen
28S ribosomal protein S29, mitochondrial recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSL
GMFHLLVAVDGINALWGRTTLKREDKSPIAPEELA
LVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAY
LPQELLGKEGFDALDPFIPILVSNYNPKEF
Storage
-20C
Provider Type Product Number
- No reagents -