PAB20449

KHDC4 antibody from Abnova Corporation
BLOM7, KIAA0907, SNORA80EHG

Antibody data

Product number
PAB20449
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20449, RRID:AB_10965618
Product name
KIAA0907 polyclonal antibody
Provider product page
Abnova Corporation - PAB20449
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant KIAA0907.
Antigen sequence
KGKLKPTQNASEKLQAPGKGLTSNKSKDDLVVAEV
EINDVPLTCRNLLTRGQTQDEISRLSGAAVSTRGR
FMTTEEKAKVGPGDRPLYLHVQGQTRELVDRAVNR
IKEIITNGVVKAATGTSPTFNGATVTVYHQPAP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -