HPA007007

NES antibody from Atlas Antibodies
FLJ21841
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA007007
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007007, RRID:AB_1854381
Product name
Anti-NES
Provider product page
Atlas Antibodies - HPA007007
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DPEGQSQQVGAPGLQAPQGLPEAIEPLVEDDVAPG
GDQASPEVMLGSEPAMGESAAGAEPGPGQGVGGLG
DPGHLTREEVMEPPLEEESLEAKRVQGLEGPRKDL
EEAGGLGTEFSELP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -