HPA007007

NES antibody from Sigma-Aldrich
FLJ21841
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007007
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007007, RRID:AB_1854381
Product name
Anti-NES antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007007
Antibody type
Polyclonal
Antigen
Nestin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DPEGQSQQVGAPGLQAPQGLPEAIEPLVEDDVAPG
GDQASPEVMLGSEPAMGESAAGAEPGPGQGVGGLG
DPGHLTREEVMEPPLEEESLEAKRVQGLEGPRKDL
EEAGGLGTEFSELP
Storage
-20C
Provider Type Product Number
- No reagents -