HPA026111

NES antibody from Sigma-Aldrich
FLJ21841
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026111
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026111, RRID:AB_1854382
Product name
Anti-NES antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026111
Antibody type
Polyclonal
Antigen
Nestin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPLRSLEDENKEAFRSLEKENQEPLKTLEEEDQSI
VRPLETENHKSLRSLEEQDQETLRTLEKETQQRRR
SLGEQDQMTLRPPEKVDLEPLKSLDQEIARPLENE
NQEFLKSLKEESVEAVKSLETEILESLKSAGQENL
ETLK
Storage
-20C
Provider Type Product Number
- No reagents -