HPA023534

ZNF23 antibody from Atlas Antibodies
KOX16, Zfp612, ZNF359, ZNF612

Antibody data

Product number
HPA023534
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023534, RRID:AB_1859140
Product name
Anti-ZNF23
Provider product page
Atlas Antibodies - HPA023534
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITG
EQPSGCTGLGKSISFDTKLVKHEIINSEERPFKCE
ELVEPFRCDSQLIQHQENNTEEKPYQCSECG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.