Antibody data

Product number
H00007571-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007571-M02, RRID:AB_1237912
Product name
ZNF23 monoclonal antibody (M02), clone 2D3
Provider product page
Abnova Corporation - H00007571-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF23.
Antigen sequence
GLQGLQTDIQTDNDLTKEMYEGKENVSFELQRDFS
QETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTV
KDETSPVEECFFSQSSNSYQCHTITGEQP
Isotype
IgG
Antibody clone number
2D3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -