HPA023534

ZNF23 antibody from Sigma-Aldrich
KOX16, Zfp612, ZNF359, ZNF612
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023534
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023534, RRID:AB_1859140
Product name
Anti-ZNF23 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023534
Antibody type
Polyclonal
Antigen
Zinc finger protein 23 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITG
EQPSGCTGLGKSISFDTKLVKHEIINSEERPFKCE
ELVEPFRCDSQLIQHQENNTEEKPYQCSECG
Storage
-20C
Provider Type Product Number
- No reagents -