HPA014658

ARHGEF11 antibody from Sigma-Aldrich
GTRAP48, KIAA0380, PDZ-RHOGEF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014658
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014658, RRID:AB_1850428
Product name
Anti-ARHGEF11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014658
Antibody type
Polyclonal
Antigen
Rho guanine nucleotide exchange factor 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FIICTSKLGPPQIYELVALTSSDKNTWMELLEEAV
RNATRHPGAAPMPVHPPPPGPREPAQQGPTPSRVE
LDDSDVFHGEPEPEELPGGTGSQQRVQGKHQVLLE
DPEQEGSAEEEELGVLPCPSTSLDGENRGIR
Storage
-20C
Provider Type Product Number
- No reagents -