HPA010872

RAB25 antibody from Sigma-Aldrich
CATX-8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010872
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010872, RRID:AB_1079729
Product name
Anti-RAB25 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010872
Antibody type
Polyclonal
Antigen
Ras-related protein Rab-25 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLV
GNKSDLSQAREVPTEEARMFAENNGLLFLETSALD
STNVEL
Storage
-20C
Provider Type Product Number
- No reagents -