ABIN183224

CHST4 antibody from antibodies-online
HEC-GLCNAC-6-ST, LSST

Antibody data

Product number
ABIN183224
Provider
antibodies-online
Product name
anti-Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 4 (CHST4) (Middle Region) antibody
Provider product page
antibodies-online - ABIN183224
Antibody type
Polyclonal
Antigen
The immunogen for anti-CHST4 antibody: synthetic peptide directed towards the middle region of human CHST4
Description
Protein A purified
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
CSQQPFEVVEKACRSYSHVVLKEVRFFNLQSLYPL
LKDPS LNLHIVHLVR
Epitope
Middle Region
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -