HPA022433

GARNL3 antibody from Atlas Antibodies
bA356B19.1, DKFZp761J1523
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022433
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022433, RRID:AB_1849472
Product name
Anti-GARNL3
Provider product page
Atlas Antibodies - HPA022433
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LVSTDAGVLLVDDDLPSVPVFDRTLPVKQMHVLET
LDLLVLRADKGKDARLFVFRLSALQKGLEGKQAGK
SRSDCRENKLEKTKGCHLYAINTHHS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -