HPA022433

GARNL3 antibody from Sigma-Aldrich
bA356B19.1, DKFZp761J1523
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022433
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022433, RRID:AB_1849472
Product name
Anti-GARNL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022433
Antibody type
Polyclonal
Antigen
GTPase-activating Rap/Ran-GAP domain-like protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVSTDAGVLLVDDDLPSVPVFDRTLPVKQMHVLET
LDLLVLRADKGKDARLFVFRLSALQKGLEGKQAGK
SRSDCRENKLEKTKGCHLYAINTHHS
Storage
-20C
Provider Type Product Number
- No reagents -