HPA010873

ALDH9A1 antibody from Sigma-Aldrich
ALDH4, ALDH7, ALDH9, E3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010873
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010873, RRID:AB_1078126
Product name
Anti-ALDH9A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010873
Antibody type
Polyclonal
Antigen
4-Trimethylaminobutyraldehyde dehydrogenase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEI
LDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPH
LERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDG
YYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFD
Storage
-20C
Provider Type Product Number
- No reagents -