H00057645-B01

POGK antibody from Abnova Corporation
BASS2, KIAA15131, KRBOX2, LST003

Antibody data

Product number
H00057645-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057645-B01, RRID:AB_982810
Product name
POGK MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00057645-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human POGK protein.
Antigen sequence
MESTAYPLNLSLKEEEEEEEIQSRELEDGPADMQK
VRICSEGGWVPALFDEVAIYFSDEEWEVLTEQQKA
LYREVMRMNYETVLSLEFPFPKPDMITRLEGEEES
QNSDEWQLQGGTSAENEESDVKPPDWPNPMNATSQ
FPQPQHFDSFGLRLPRDITELPEWSEGYPFYMAMG
FPGYDLSADDIAGKFQFSRGMRRSYDAGFKLMVVE
YAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAH
AMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPI
TREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMR
RYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALR
RAHDYEVAQMGNADETPICLEVPSRVTVDNQGEKP
VLVKTPGREKLKITAMLGVLADGRKLPPYIILRGT
YIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEVVWR
RRTGAVPKQRGMLILNGFRGHATDSVKNSMESMNT
DMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNW
LLAGNLALSPTGNAKKPPLGLFLEWVMVAWNSISS
ESIVQGFKKCHISSNLEEEDDVLWEIESELPGGGE
PPKDCDTESMAESN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -