HPA007838

POGK antibody from Sigma-Aldrich
BASS2, KIAA15131, KRBOX2, LST003
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007838
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007838, RRID:AB_1079651
Product name
Anti-POGK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007838
Antibody type
Polyclonal
Antigen
Pogo transposable element with KRAB domain recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LYREVMRMNYETVLSLEFPFPKPDMITRLEGEEES
QNSDEWQLQGGTSAENEESDVKPPDWPNPMNATSQ
FPQPQHFDSFGLRLPRDITELPEWSEGYPFYMAMG
FPGYDLSADDIAGKFQFSRGMRRSYDAGFKLMVVE
YA
Storage
-20C
Provider Type Product Number
- No reagents -