H00003963-M01

LGALS7 antibody from Abnova Corporation
GAL7, LGALS7A, PIG1, TP53I1

Antibody data

Product number
H00003963-M01
Provider
Abnova Corporation
Product name
LGALS7 monoclonal antibody (M01), clone 6B5
Provider product page
Abnova Corporation - H00003963-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant LGALS7.
Antigen sequence
MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHV
NLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSW
GREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDA
QYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Isotype
IgG
Antibody clone number
6B5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -