HPA001549

LGALS7 antibody from Atlas Antibodies
GAL7, LGALS7A, PIG1, TP53I1

Antibody data

Product number
HPA001549
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001549, RRID:AB_1078938
Product name
Anti-LGALS7
Provider product page
Atlas Antibodies - HPA001549
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLC
GEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREE
RGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHH
FRHRLPLARVRLVEVGGDVQLDSV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.