HPA001549

LGALS7 antibody from Sigma-Aldrich
GAL7, LGALS7A, PIG1, TP53I1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001549
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001549, RRID:AB_1078938
Product name
Anti-LGALS7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001549
Antibody type
Polyclonal
Antigen
Galectin-7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLC
GEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREE
RGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHH
FRHRLPLARVRLVEVGGDVQLDSV
Storage
-20C
Provider Type Product Number
- No reagents -