HPA020999

GIGYF1 antibody from Atlas Antibodies
GYF1, PERQ1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020999
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020999, RRID:AB_2111744
Product name
Anti-GIGYF1
Provider product page
Atlas Antibodies - HPA020999
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DTLEAKEFAKQFLERRAKQKASQQRQQQQEAWLSS
ASLQTAFQANHSTKLGPGEGSKAKRRALMLHSDPS
ILGYSL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -