HPA020999

GIGYF1 antibody from Sigma-Aldrich
GYF1, PERQ1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020999
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020999, RRID:AB_2111744
Product name
Anti-GIGYF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020999
Antibody type
Polyclonal
Antigen
PERQ amino acid-rich with GYF domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DTLEAKEFAKQFLERRAKQKASQQRQQQQEAWLSS
ASLQTAFQANHSTKLGPGEGSKAKRRALMLHSDPS
ILGYSL
Storage
-20C
Provider Type Product Number
- No reagents -