Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024153 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024153, RRID:AB_1846664
- Product name
- Anti-CHKA
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FDIGNHFCEWMYDYSYEKYPFFRANIRKYPTKKQQ
LHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVN
RFALASHFLWGLWSIVQAKIS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines SK-MEL-30 and U-251MG using Anti-CHKA antibody. Corresponding CHKA RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line SK-BR-3.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix shows moderate to strong positivity in mucus in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymphoid tissues shows moderate cytoplasmic positivity in lymphoid cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows weak to moderate positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
- Sample type
- HUMAN