HPA024153

CHKA antibody from Atlas Antibodies
CHK, CKI
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024153
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024153, RRID:AB_1846664
Product name
Anti-CHKA
Provider product page
Atlas Antibodies - HPA024153
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FDIGNHFCEWMYDYSYEKYPFFRANIRKYPTKKQQ
LHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVN
RFALASHFLWGLWSIVQAKIS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -