Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001119-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001119-A01, RRID:AB_463508
- Product name
- CHKA polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CHKA.
- Antigen sequence
ILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNH
FCEWMYDYSYEKYPFFRANIRKYPTKKQQLHFISS
YLPAFQNDFENLSTEEKSIIKEEMLLEVNR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Influence of multidrug resistance on (18)F-FCH cellular uptake in a glioblastoma model.
Vanpouille C, Le Jeune N, Kryza D, Clotagatide A, Janier M, Dubois F, Perek N
European journal of nuclear medicine and molecular imaging 2009 Aug;36(8):1256-64
European journal of nuclear medicine and molecular imaging 2009 Aug;36(8):1256-64
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CHKA polyclonal antibody (A01), Lot # GPC1060208QCS1 Western Blot analysis of CHKA expression in A-431 ( Cat # L015V1 ).