HPA024153

CHKA antibody from Sigma-Aldrich
CHK, CKI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024153
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024153, RRID:AB_1846664
Product name
Anti-CHKA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024153
Antibody type
Polyclonal
Antigen
Choline kinase alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FDIGNHFCEWMYDYSYEKYPFFRANIRKYPTKKQQ
LHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVN
RFALASHFLWGLWSIVQAKIS
Storage
-20C
Provider Type Product Number
- No reagents -